Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mpv17-like protein (Mpv17l)

This Recombinant Mouse Mpv17-like protein (Mpv17l) spans the amino acid sequence from region 1-194.

Product Specifications

Product Name Alternative

Mpv17-like protein, M-LP

UniProt

Q99MS3

Expression Region

1-194

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASWWRAFPQAARRYPWPTNVLLYAGLFSAGDALQQRLRGGPADWRQTRRVATLAVTFHG NFNYVWLRLLERALPGRAPRTVLAKVLCDQTVGGPIALSAFYVGMSVLQGKDDIFLDLKQ KFWNTYKSGLMYWPFVQLTNFSLVPVHWRTAYTGLCAFLWATFLCFSQQSGDGTLQSIFI FLRRKEASDKSPEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluid Thio Medium 500gm
225650 1 Each

Fluid Thio Medium 500gm

Sign In for Pricing
View Details
Lentiviral mouse Dnaaf3 shRNA (UAS) - Lentiviral mouse Dnaaf3 shRNA (UAS, GFP) plasmid
GTR15213226 1 Vial

Lentiviral mouse Dnaaf3 shRNA (UAS) - Lentiviral mouse Dnaaf3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
PKM2, CT (C474) (Pyruvate Kinase, Isozymes M1/M2, Pyruvate Kinase Muscle Isozyme, Cytosolic Thyroid Hormone-binding Protein, CTHBP, Opa-interacting Protein 3, OIP-3, Pyruvate Kinase 2/3, Thyroid Hormone-binding Protein 1, THBP1, Tumor M2-PK, p58, PKM, OIP3, PK2, PK3) (PE) discontinued
P9545-31J-PE 200 µL

PKM2, CT (C474) (Pyruvate Kinase, Isozymes M1/M2, Pyruvate Kinase Muscle Isozyme, Cytosolic Thyroid Hormone-binding Protein, CTHBP, Opa-interacting Protein 3, OIP-3, Pyruvate Kinase 2/3, Thyroid Hormone-binding Protein 1, THBP1, Tumor M2-PK, p58, PKM, OIP3, PK2, PK3) (PE) discontinued

Sign In for Pricing
View Details
Fc Fragment of IgG Low Affinity IIIa Receptor (FCGR3A) Antibody (PE)
abx139437 100 Tests

Fc Fragment of IgG Low Affinity IIIa Receptor (FCGR3A) Antibody (PE)

Sign In for Pricing
View Details
H3F3B Protein Lysate (Mouse) with C-HA Tag
22973034 100 µg

H3F3B Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
C15orf2 AAV siRNA Pooled Vector
13874161 1.0 µg

C15orf2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details