Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxisomal membrane protein 2 (PXMP2)

This Recombinant Human Peroxisomal membrane protein 2 (PXMP2) spans the amino acid sequence from region 2-195.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein 2, 22 kDa peroxisomal membrane protein

UniProt

Q9NR77

Expression Region

2-195

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKK ENSRSLDVGGPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAF LMLFFLIMNFLEGKDASAFAAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANL AALFWYAYLASLGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGB3BP Human Gene Knockout Kit (CRISPR)
KN400064 1 Kit

ITGB3BP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-(2-Butylamino)ethanol
TRC-B693945-5G 5 g

2-(2-Butylamino)ethanol

Sign In for Pricing
View Details
Pancreatic Lipase Related Protein 2 (PNLIPRP2) Rabbit Polyclonal Antibody
TA380097 100 µL

Pancreatic Lipase Related Protein 2 (PNLIPRP2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pancreatic Polypeptide Recombinant Rabbit monoclonal Antibody
HA750664 100 µL

Pancreatic Polypeptide Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Acvr2a Mouse Gene Knockout Kit (CRISPR)
KN500803 1 Kit

Acvr2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MMP7 Human Gene Knockout Kit (CRISPR)
KN401225 1 Kit

MMP7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details