Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxisomal membrane protein 2 (PXMP2)

This Recombinant Human Peroxisomal membrane protein 2 (PXMP2) spans the amino acid sequence from region 2-195.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein 2, 22 kDa peroxisomal membrane protein

UniProt

Q9NR77

Expression Region

2-195

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKK ENSRSLDVGGPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAF LMLFFLIMNFLEGKDASAFAAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANL AALFWYAYLASLGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arntl Mouse Gene Knockout Kit (CRISPR)
KN301604RB 1 Kit

Arntl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Col5a2 activation kit by CRISPRa
GA200820 1 Kit

Mouse Col5a2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human DOT1L activation kit by CRISPRa
GA113549 1 Kit

Human DOT1L activation kit by CRISPRa

Sign In for Pricing
View Details
CD66 (CEA) (COL-1), CF488A conjugate, 0.1mg/mL
BNC880002-100 1x 100 µL

CD66 (CEA) (COL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMM50 (NM_001001563) Human Over-expression Lysate
LY424383 100 µg

TIMM50 (NM_001001563) Human Over-expression Lysate

Sign In for Pricing
View Details
3Beta-Hydroxyandrost-5-en-17-one Hydrazone
TRC-H828140-1G 1 g

3Beta-Hydroxyandrost-5-en-17-one Hydrazone

Sign In for Pricing
View Details