Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxisomal membrane protein 2 (PXMP2)

This Recombinant Human Peroxisomal membrane protein 2 (PXMP2) spans the amino acid sequence from region 2-195.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein 2, 22 kDa peroxisomal membrane protein

UniProt

Q9NR77

Expression Region

2-195

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKK ENSRSLDVGGPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAF LMLFFLIMNFLEGKDASAFAAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANL AALFWYAYLASLGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mono-5-carboxypentyl Phthalate-d4
TRC-M525497-1MG 1 mg

Mono-5-carboxypentyl Phthalate-d4

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS702464 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Acrylonitrile-2-d1
TRC-A191383-10MG 10 mg

Acrylonitrile-2-d1

Sign In for Pricing
View Details
T Plastin (PLS3) (NM_001172335) Human Recombinant Protein
TP330333M 100 µg

T Plastin (PLS3) (NM_001172335) Human Recombinant Protein

Sign In for Pricing
View Details
URB1 Human Gene Knockout Kit (CRISPR)
KN426482 1 Kit

URB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cell Meter™ Annexin V Binding Apoptosis Assay Kit *Blue Fluorescence Excited at 405 nm*
22828-AAT 100 Tests

Cell Meter™ Annexin V Binding Apoptosis Assay Kit *Blue Fluorescence Excited at 405 nm*

Sign In for Pricing
View Details