Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus epidermidis Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-194.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

P0C0N5

Expression Region

1-194

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIIDKKIEQFAQYLQRKNNLDHIQFLKIRLGMQVLAINIEKSIVVYGLAIIFHTFFYTL LTHLSYFLIRRHAHGTHANSSLLCHIQNIIFFIIFPYLIIKLDINYFVLLSMALVGLIIT ILYAPAATKKQPIPRRLVKRKKILSIFLYCTIVVISLVTKEPVNKLILFGVILESLTLLP IFFPKEDINHGKHF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

POU2F3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
37259066 1.0 µg DNA

POU2F3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Bromocresol Green sodium salt
GT3714-25g 25 g

Bromocresol Green sodium salt

Sign In for Pricing
View Details
REEP1 Antibody
OAAN02459-200UL 200 µL

REEP1 Antibody

Sign In for Pricing
View Details
Olr1437 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7457303 1.0 µg DNA

Olr1437 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal RBED1 Antibody
NBP1-79821 100 µL

Rabbit Polyclonal RBED1 Antibody

Sign In for Pricing
View Details
Rat Fibin ELISA Kit
ELI-44002r 96 Tests

Rat Fibin ELISA Kit

Sign In for Pricing
View Details