Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Accessory gene regulator protein B (agrB)

This Recombinant Staphylococcus epidermidis Accessory gene regulator protein B (agrB) spans the amino acid sequence from region 1-194.

Product Specifications

Product Name Alternative

Accessory gene regulator protein B, EC= 3.4.-.-

UniProt

P0C0N5

Expression Region

1-194

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIIDKKIEQFAQYLQRKNNLDHIQFLKIRLGMQVLAINIEKSIVVYGLAIIFHTFFYTL LTHLSYFLIRRHAHGTHANSSLLCHIQNIIFFIIFPYLIIKLDINYFVLLSMALVGLIIT ILYAPAATKKQPIPRRLVKRKKILSIFLYCTIVVISLVTKEPVNKLILFGVILESLTLLP IFFPKEDINHGKHF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSH1 siRNA (m)
sc-153842 10 µM

SSH1 siRNA (m)

Sign In for Pricing
View Details
S100a3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3420505 3x 1.0 µg

S100a3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Scavenger receptor class B member 1 (SCARB1) ELISA Kit
AE20638MO-01 48 Tests

Mouse Scavenger receptor class B member 1 (SCARB1) ELISA Kit

Sign In for Pricing
View Details
Mouse Scavenger receptor class B member 1 (SCARB1) ELISA Kit
AE20638MO-02 96 Tests

Mouse Scavenger receptor class B member 1 (SCARB1) ELISA Kit

Sign In for Pricing
View Details
MYCMI-6 200mg
A22700-200 200 mg

MYCMI-6 200mg

Sign In for Pricing
View Details
Hibadh Mouse Gene Knockout Kit (CRISPR)
KN507703 1 Kit

Hibadh Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details