Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Casparian strip membrane protein 4

This Recombinant Glycine max Casparian strip membrane protein 4 spans the amino acid sequence from region 1-195.

Product Specifications

Product Name Alternative

Casparian strip membrane protein 4

UniProt

C6T1K6

Expression Region

1-195

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTTIDVPESNNVAKEKVLLLGARPRPGGWKKGVAIMDFILRLGAIAAAPGAAATMGTSD QTLPFFTQFFQFEASYDSFTTFQFFVITMALVAGYLVLSLPFSIVVIIRPHAVGPRLFLI ILDTVFLTLATASGASAAAIVYLAHNGNQDSNWLAICNQFGDFCAQTSGAVVSSLVSVVI FVLLIVMSALALRRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-500 1x 500 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-500 1x 500 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF647 conjugate, 0.1mg/mL
BNC472383-100 1x 100 µL

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hepatocyte Specific (CPS1/1022), CF740 conjugate, 0.1mg/mL
BNC741022-500 1x 500 µL

Hepatocyte Specific (CPS1/1022), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details