Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_683682 (ARALYDRAFT_683682)

This Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_683682 (ARALYDRAFT_683682) spans the amino acid sequence from region 1-195.

Product Specifications

Product Name Alternative

CASP-like protein ARALYDRAFT_683682

UniProt

D7MM00

Expression Region

1-195

Origin

Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKLALAATSGKSCKILLGLRLLAFSATLSAAIVMGLNKETETFVVGKVGNTPIKATFTA KFDHTPAFVFFVVANAMVSFHNLLMIALQIFGGKMEFTGFRLLSVAILDMLNVTLISAAA NAAAFMAEVGKNGNKHARWDKICDRFATYCDHGAGALIAAFAGVILMLIISAASISRLAQ QNKCCSTTASPSVVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-500 1x 500 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-100 1x 100 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), 0.2mg/mL
BNUB0871-500 1x 500 µL

CD71 (66IG10), 0.2mg/mL

Sign In for Pricing
View Details
Fibronectin (2755-8), CF594 conjugate, 0.1mg/mL
BNC940091-100 1x 100 µL

Fibronectin (2755-8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF740 conjugate, 0.1mg/mL
BNC741118-500 1x 500 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF405S conjugate, 0.1mg/mL
BNC041857-100 1x 100 µL

Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details