Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Protein SYM1 (SYM1)

This Recombinant Candida albicans Protein SYM1 (SYM1) spans the amino acid sequence from region 1-195.

Product Specifications

Product Name Alternative

Protein SYM1

UniProt

Q59Q43

Expression Region

1-195

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYIFNRYNALLLRRPLITNMITTGLLVGGGDALAQFFFPNNDNNNLEQQPFDYLRNLRA IIYGSLIFAPIGDKWYKFLNTKVVWTRNAQKPQYQRSMSTLLRVMVDQLVFAPFIGIPLY YSSMTILENRQPFLDNIIDKFNTSWWITLKSNWLVWPLFQFFNFYLLPVQFRLLAVNIIS IGWNTYLSYVMHSQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COG6 Polyclonal Antibody
MBS2547636-01 0.06 mL

COG6 Polyclonal Antibody

Sign In for Pricing
View Details
COG6 Polyclonal Antibody
MBS2547636-02 0.12 mL

COG6 Polyclonal Antibody

Sign In for Pricing
View Details
COG6 Polyclonal Antibody
MBS2547636-03 0.2 mL

COG6 Polyclonal Antibody

Sign In for Pricing
View Details
COG6 Polyclonal Antibody
MBS2547636-04 5x 0.2 mL

COG6 Polyclonal Antibody

Sign In for Pricing
View Details
WNK2 (WNK Lysine deficient Protein Kinase 2, KIAA1760, NY-CO-43, P/OKcl.13, PRKWNK2, SDCCAG43) (MaxLight 405) discontinued
253458-ML405 100 µL

WNK2 (WNK Lysine deficient Protein Kinase 2, KIAA1760, NY-CO-43, P/OKcl.13, PRKWNK2, SDCCAG43) (MaxLight 405) discontinued

Sign In for Pricing
View Details
FABP2 Antibody
orb2312225-01 20 µg

FABP2 Antibody

Sign In for Pricing
View Details