What is the catalog number for Recombinant Inner membrane protein ydjM (ydjM)?

The catalog number for Recombinant Inner membrane protein ydjM (ydjM) is orb2918949.

What sizes are available for Recombinant Inner membrane protein ydjM (ydjM)?

Recombinant Inner membrane protein ydjM (ydjM) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Inner membrane protein ydjM (ydjM) come in?

Recombinant Inner membrane protein ydjM (ydjM) is available in 2 different pack sizes.

Is Recombinant Inner membrane protein ydjM (ydjM) in stock?

Recombinant Inner membrane protein ydjM (ydjM) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Inner membrane protein ydjM (ydjM)

This Recombinant Inner membrane protein ydjM (ydjM) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

Inner membrane protein ydjM

UniProt

P64482

Expression Region

1-196

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAEGHLLFSIACAVFAKNAELTPVLAQGDWWHIVPSAILTCLLPDIDHPKSFLGQRLKW ISKPIARAFGHRGFTHSLLAVFALLATFYLKVPEGWFIPADALQGMVLGYLSHILADMLT PAGVPLLWPCRWRFRLPILVPQKGNQLERFICMALFVWSVWMPHSLPENSAVRWSSQMIN TLQIQFHRLIKHQVEY