Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein ydjM (ydjM)

This Recombinant Inner membrane protein ydjM (ydjM) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

Inner membrane protein ydjM

UniProt

P64482

Expression Region

1-196

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAEGHLLFSIACAVFAKNAELTPVLAQGDWWHIVPSAILTCLLPDIDHPKSFLGQRLKW ISKPIARAFGHRGFTHSLLAVFALLATFYLKVPEGWFIPADALQGMVLGYLSHILADMLT PAGVPLLWPCRWRFRLPILVPQKGNQLERFICMALFVWSVWMPHSLPENSAVRWSSQMIN TLQIQFHRLIKHQVEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD2 Antibody (rLFA2/8516) [DyLight 405]
NBP3-20815V 0.1 mL

Mouse Monoclonal CD2 Antibody (rLFA2/8516) [DyLight 405]

Sign In for Pricing
View Details
Olr1654 ORF Vector (Rat) (pORF)
ORF072220 1.0 µg DNA

Olr1654 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Defb7 Mouse Gene Knockout Kit (CRISPR)
KN504481 1 Kit

Defb7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SSX1-set siRNA/shRNA/RNAi Lentivector (Human)
45570091 4x 500 ng

SSX1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Mouse Selenium-binding protein 1,SELENBP1 ELISA KIT
JOT-EK1372Mo-01 96 Well

Mouse Selenium-binding protein 1,SELENBP1 ELISA KIT

Sign In for Pricing
View Details
Mouse Selenium-binding protein 1,SELENBP1 ELISA KIT
JOT-EK1372Mo-02 48 Well

Mouse Selenium-binding protein 1,SELENBP1 ELISA KIT

Sign In for Pricing
View Details