Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_820933 (POPTRDRAFT_820933)

This Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_820933 (POPTRDRAFT_820933) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

CASP-like protein POPTRDRAFT_820933

UniProt

B9HMP5

Expression Region

1-196

Origin

Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASTDKPDRESIKSEEAPAAHPRRSNYSSVHVALRFLLFAASVTAVVVMVTAKQTKIVPV PGFPISVPLEAKFSDSPAFIYFISALSVAGLYGILTTLAAISIVLKPAYATRFLLHFALL DVLMLGIVASATGAAGGVAYVGLKGNSHVRWGKVCNVYDKFCQHVGSSIAVALFASVLLV LLTMLSVFSIYRKIPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM8 Polyclonal Antibody
E-AB-17996-01 20 µL

TRIM8 Polyclonal Antibody

Sign In for Pricing
View Details
TRIM8 Polyclonal Antibody
E-AB-17996-02 60 µL

TRIM8 Polyclonal Antibody

Sign In for Pricing
View Details
TRIM8 Polyclonal Antibody
E-AB-17996-03 120 µL

TRIM8 Polyclonal Antibody

Sign In for Pricing
View Details
TRIM8 Polyclonal Antibody
E-AB-17996-04 200 µL

TRIM8 Polyclonal Antibody

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), Biotin conjugate, 0.1mg/mL
BNCB1974-500 1x 500 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARIH2 Rabbit Polyclonal Antibody
TA366301 100 µL

ARIH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details