Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 126A (Tmem126a)

This Recombinant Mouse Transmembrane protein 126A (Tmem126a) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

Transmembrane protein 126A

UniProt

Q9D8Y1

Expression Region

1-196

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESHKPSTSKDDLILNIISRKIKQLPESDRNLLEYGSAYIGLNAAFGGLIANSLFRRILN VTQARLASSLPMAVIPFLTANLSYQSLVSLPLSTGDLNCETCTTTRGALVGLVMGGLYPI LLAIPVNGGLAARYESSPLPQRGNIFNYWITVSKPVFRKMLFPTLLQTVFASYLGSRQYK LLIKALQLPEPDLEIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

V5 tag Recombinant Rabbit monoclonal Antibody
HA750086 100 µL

V5 tag Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
13-Ethyl-17-hydroxy-18,19-dinor-17Alpha-pregn-5(10)-en-20-yn-3-one(Levo Norgestrel Impurity)
TRC-E918935-25MG 25 mg

13-Ethyl-17-hydroxy-18,19-dinor-17Alpha-pregn-5(10)-en-20-yn-3-one(Levo Norgestrel Impurity)

Sign In for Pricing
View Details
PSA (Prostate Specific Antigen) (A67-B/E3), CF640R conjugate, 0.1mg/mL
BNC400883-500 1x 500 µL

PSA (Prostate Specific Antigen) (A67-B/E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (9E10.3), CF405S conjugate, 0.1mg/mL
BNC040596-500 1x 500 µL

C-Myc (9E10.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
∆4-Tibolone
TRC-T437505-25MG 25 mg

∆4-Tibolone

Sign In for Pricing
View Details
OR5H2 (C-term) Rabbit Polyclonal Antibody
AP53091PU-N 400 µL

OR5H2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details