Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Mpv17-like protein (MPV17L)

This Recombinant Bovine Mpv17-like protein (MPV17L) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

Mpv17-like protein, M-LP homolog, M-LPH

UniProt

Q2KIK2

Expression Region

1-196

Origin

Bos taurus (Bovine)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWWQALTRAAGRYPWPANVLLYAGFFSGGDALQQVLRGGPADWQHTRHVATVAVAFHA NLNYVWLNLLERALPGRAPRTILAKVLCDQALGGPVYVSTFYAGMSILQGKDDIFLDMRQ KFWNTYKSGLMYWPFVQLINFSLIPIRWRTAYTGLCGFLWATFLCFSQQEGDGTFKSAFT FRRIKVTNEVEKPSEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-100 1x 100 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-500 1x 500 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL
BNC680437-500 1x 500 µL

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-100 1x 100 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-100 1x 100 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF405S conjugate, 0.1mg/mL
BNC041922-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details