Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein TEX261 (TEX261)

This Recombinant Human Protein TEX261 (TEX261) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

Protein TEX261

UniProt

Q6UWH6

Expression Region

1-196

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWFMYLLSWLSLFIQVAFITLAVAAGLYYLAELIEEYTVATSRIIKYMIWFSTAVLIGLY VFERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQFFAEEYY PFSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTMQPGDDVVSNYFTKGKRGKRLGILVV FSFIKEAILPSRQKIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2CD4D Adenovirus (Rat)
14389056 1.0 mL

C2CD4D Adenovirus (Rat)

Sign In for Pricing
View Details
BCAM BioAssayTM ELISA Kit (Mouse)
396567 96 Tests

BCAM BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
Recombinant Pasteurella multocida UPF0758 protein PM1152 (PM1152)
MBS1216308-01 0.02 mg (E-Coli)

Recombinant Pasteurella multocida UPF0758 protein PM1152 (PM1152)

Sign In for Pricing
View Details
Recombinant Pasteurella multocida UPF0758 protein PM1152 (PM1152)
MBS1216308-02 0.1 mg (E-Coli)

Recombinant Pasteurella multocida UPF0758 protein PM1152 (PM1152)

Sign In for Pricing
View Details
Recombinant Pasteurella multocida UPF0758 protein PM1152 (PM1152)
MBS1216308-03 0.02 mg (Yeast)

Recombinant Pasteurella multocida UPF0758 protein PM1152 (PM1152)

Sign In for Pricing
View Details
Recombinant Pasteurella multocida UPF0758 protein PM1152 (PM1152)
MBS1216308-04 0.1 mg (Yeast)

Recombinant Pasteurella multocida UPF0758 protein PM1152 (PM1152)

Sign In for Pricing
View Details