Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative K (+) -stimulated pyrophosphate-energized sodium pump (hppA)

This Recombinant Putative K (+) -stimulated pyrophosphate-energized sodium pump (hppA) spans the amino acid sequence from region 1-197.

Product Specifications

Product Name Alternative

Putative K (+) -stimulated pyrophosphate-energized sodium pump, EC= 3.6.1.1, Membrane-bound sodium-translocating pyrophosphatase, Pyrophosphate-energized inorganic pyrophosphatase, Na (

UniProt

Q8VNJ8

Expression Region

1-197

Origin

Heliobacterium chlorum

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGGIAEMAELGPEVRKKTDKLDAVGNTTAAVAKGFAIGSAALTALALFTAFAEEVVKSPG VSSALHGSHFVLNLLEPKIIIGLFIGGTVPFLFCAFAMEAVGKAAFEMIGEVRRQFREIP GLMEGKAKPDYARCVDISTRAAIRQMIAPGLLAVITPLIVGFGFGAQALGGMLAGVTVAG VLLAIFMANAGGAWDHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SnoN (SKIL) Rabbit Polyclonal Antibody
AP20409PU-N 100 µg

SnoN (SKIL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS703234 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
1-O-Levulinoyl Resveratrol Diacetate
TRC-L379700-10MG 10 mg

1-O-Levulinoyl Resveratrol Diacetate

Sign In for Pricing
View Details
Recombinant Renilla Luciferase Antibody
RC-15399-01 50 μL

Recombinant Renilla Luciferase Antibody

Sign In for Pricing
View Details
Recombinant Renilla Luciferase Antibody
RC-15399-02 100 µL

Recombinant Renilla Luciferase Antibody

Sign In for Pricing
View Details
Recombinant Renilla Luciferase Antibody
RC-15399-03 1 mL

Recombinant Renilla Luciferase Antibody

Sign In for Pricing
View Details