Recombinant Thermoanaerobacter sp. Glycerol-3-phosphate acyltransferase (plsY)
This Recombinant Thermoanaerobacter sp. Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-198.
Product Specifications
Product Name Alternative
Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati
UniProt
B0K3E3
Expression Region
1-198
Origin
Thermoanaerobacter sp. (strain X514)
Field of Research
Pharmacology & Drug Discovery
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MYAVLTAIIAYLIGCINNAYIFTKYTRNIDIRNYGSGNAGATNVLRVLGYKAAAPVFALD VLKGVIAVLIGKYLMGNTGAMIAGIAVVCGHNWPVFLKFRGGKGIATSVGVVMTVSPLLG LIALAIGVTVIVLTKYVSLGSITGSVTFVLLNAIFWNSTQIFIFSLILASLAIFQHRSNI KRLLAGTESKLGQKTEIK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680149-500 1x 500 µL
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041045-500 1x 500 µL
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401884-500 1x 500 µL
Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details