Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 17 (Tmem17)

This Recombinant Mouse Transmembrane protein 17 (Tmem17) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

Transmembrane protein 17

UniProt

Q8K0U3

Expression Region

1-198

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELPDPVRQRLSNLSLTVFGDSSRTGPESSDAADNEMVSSLALQMSLYFNSYFFPLWWVS CIVMLHLKYSILPDYYKFIVVTVVILITLIEAIRLYLGCMGNLQEKVPELAGFWLLSLLL QLPLILFLLLNDGLRNLPLEKAIHIIFTIFLTFQVISAFLTLKKMVNQLAARFHLQDFDQ LSSSSAAVRRVRQCTEEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK8 (NM_001260) Human Over-expression Lysate
LY400507 100 µg

CDK8 (NM_001260) Human Over-expression Lysate

Sign In for Pricing
View Details
RAD51 Rabbit Polyclonal Antibody
AP21140PU-N 100 µg

RAD51 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Neuroligin 3 (NLGN3) (NM_018977) Human Over-expression Lysate
LC402722 20 µg

Neuroligin 3 (NLGN3) (NM_018977) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human CD40 Protein (His Tag)
PDMH100223-01 20 µg

Recombinant Human CD40 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD40 Protein (His Tag)
PDMH100223-02 100 µg

Recombinant Human CD40 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD40 Protein (His Tag)
PDMH100223-03 500 µg

Recombinant Human CD40 Protein (His Tag)

Sign In for Pricing
View Details