Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0480 (MJ0480)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0480 (MJ0480) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0480

UniProt

Q57904

Expression Region

1-198

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGSIFDIYYKTLDAIFMPIIKVLHPALAILIIAIIVSLIINIATKLLVDQKRVAELKKE IQEFQVKFKKMSKNPEMMEKLQEEQQRIMQLNAELMKMSFRPMIYTWVPIILIFIYLRHV YGFGGVYQELNPGWNGVVVYLPIILSKILFIDFWHWLGSIFYKGGFKIVSNTALGWLGWY ILCSFATSTVLRKILGIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C6orf72 (GINM1) activation kit by CRISPRa
GA114581 1 Kit

Human C6orf72 (GINM1) activation kit by CRISPRa

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG1), CF405S conjugate, 0.1mg/mL
BNC041686-100 1x 100 µL

VEGF (Vascular Endothelial Growth Factor) (VG1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FILIP1L (NM_001282793) Human Tagged ORF Clone
RG239380 10 µg

FILIP1L (NM_001282793) Human Tagged ORF Clone

Sign In for Pricing
View Details
ING1 Antibody
KC-1103-01 50 μL

ING1 Antibody

Sign In for Pricing
View Details
ING1 Antibody
KC-1103-02 100 µL

ING1 Antibody

Sign In for Pricing
View Details
ING1 Antibody
KC-1103-03 1 mL

ING1 Antibody

Sign In for Pricing
View Details