Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian Glycerol-3-phosphate acyltransferase 2 (plsY2)

This Recombinant Bacillus thuringiensis subsp. konkukian Glycerol-3-phosphate acyltransferase 2 (plsY2) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase 2, Acyl-PO4 G3P acyltransferase 2, Acyl-phosphate--glycerol-3-phosphate acyltransferase 2, G3P acyltransferase 2, GPAT 2, EC= 2.3.1.n3, Lys

UniProt

Q6HFJ3

Expression Region

1-198

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTTYLLFIVAYLLGSIPFALVVGKIGYGIDIREHGSGNLGGTNTFRTLGKKAGFTVTIA DILKGTLATSLPMVFGLDIHPLWFGLAAVLGHVYPIFAKFRGGKAVATSAGVLLCYSPVV FAILAVVFFTLLFTTRYVSLSSMVTAVVAVIASIVSGDKIFIIAMCLLASMVIYKHRANI GRIINKTEPKANFSKKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myh6 Mouse siRNA Oligo Duplex (Locus ID 17888)
SR423307 1 Kit

Myh6 Mouse siRNA Oligo Duplex (Locus ID 17888)

Sign In for Pricing
View Details
S100A8 AAV Vector (Human) (CMV)
42944101 1 µg

S100A8 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Human MT3 ELISA Kit
MBS8427231-01 1 Kit

Human MT3 ELISA Kit

Sign In for Pricing
View Details
Human MT3 ELISA Kit
MBS8427231-02 5x 1 Kit

Human MT3 ELISA Kit

Sign In for Pricing
View Details
SB 258585 hydrochloride
1961/50 50 mg

SB 258585 hydrochloride

Sign In for Pricing
View Details
Goat NB-Ab ELISA Kit
EGTN0081 96 Tests

Goat NB-Ab ELISA Kit

Sign In for Pricing
View Details