Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Glycerol-3-phosphate acyltransferase 2 (plsY2)

This Recombinant Bacillus cereus Glycerol-3-phosphate acyltransferase 2 (plsY2) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase 2, Acyl-PO4 G3P acyltransferase 2, Acyl-phosphate--glycerol-3-phosphate acyltransferase 2, G3P acyltransferase 2, GPAT 2, EC= 2.3.1.n3, Lys

UniProt

Q733N4

Expression Region

1-198

Origin

Bacillus cereus (strain ATCC 10987)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTTYLLFIVAYLLGSIPFALVVGKIGYGIDIREHGSGNLGGTNTFRTLGKKAGFIVTIA DILKGTLATSLPIIFALDIHPLWFGLAAVLGHVYPIFAKFRGGKAVATSAGVLLCYSPVV FAILAVVFFSLLFTTRYVSLSSMVTAVVAVIASIVSGDKIFIIAMCLLAGMVIYKHRANI GRIINKTEPKANFSKKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-500 1x 500 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-500 1x 500 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-500 1x 500 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-100 1x 100 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Luteinizing Hormone beta (LH beta) (LHb/1214), CF740 conjugate, 0.1mg/mL
BNC741214-500 1x 500 µL

Luteinizing Hormone beta (LH beta) (LHb/1214), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details