Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Glycerol-3-phosphate acyltransferase 2 (plsY2)

This Recombinant Bacillus cereus Glycerol-3-phosphate acyltransferase 2 (plsY2) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase 2, Acyl-PO4 G3P acyltransferase 2, Acyl-phosphate--glycerol-3-phosphate acyltransferase 2, G3P acyltransferase 2, GPAT 2, EC= 2.3.1.n3, Lys

UniProt

Q812Z6

Expression Region

1-198

Origin

Bacillus cereus (strain ATCC 14579 / DSM 31)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTTYLLFIVAYLLGSIPFALVVGKIGYGIDIREHGSGNLGGTNTFRTLGKKAGFTVTIA DILKGTLATSLPMIFGLDIHPLWFGLAAVLGHVYPIFAKFRGGKAVATSAGVLLCYSPVV FAILAVVFFTLLFTTRYVSLSSMVTAVVAVIASIVSGDKIFIIAMCLLAGMVIYKHRANI GRIINKTEPKANFSKKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL
BNC880669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-100 1x 100 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-100 1x 100 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-500 1x 500 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details