Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella arizonae Sulfoxide reductase heme-binding subunit YedZ (yedZ)

This Recombinant Salmonella arizonae Sulfoxide reductase heme-binding subunit YedZ (yedZ) spans the amino acid sequence from region 1-199.

Product Specifications

Product Name Alternative

Sulfoxide reductase heme-binding subunit YedZ, Flavocytochrome YedZ

UniProt

A9MNV6

Expression Region

1-199

Origin

Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLTAKQIIWLKVCLHLVGFLPLLWLFWAINQGGLSADPVKDIQHFTGRTALKFLLATLL ISPLARYAKQPLLIRTRRLLGLWCFVWATLHLTSYALLELGIHNLALLGSELISRPYLTL GIISWLALLALTLTSTQFAQRKLGKRWQTLHNVVYLVAILAPVHYLWSVKVLSPQPVIYA ALALVLLALRYRKFRQWRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-500 1x 500 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-500 1x 500 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-100 1x 100 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details