Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus trichocarpa Casparian strip membrane protein POPTRDRAFT_763057 (POPTRDRAFT_763057)

This Recombinant Populus trichocarpa Casparian strip membrane protein POPTRDRAFT_763057 (POPTRDRAFT_763057) spans the amino acid sequence from region 1-199.

Product Specifications

Product Name Alternative

Casparian strip membrane protein POPTRDRAFT_763057

UniProt

B9HBX2

Expression Region

1-199

Origin

Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSESAAIDIPESSSVAKGKAPLIAVSRNEKGGYRKGIAIFDFILRLAAIATALAAAAAM GTSDETLPFFTQFFQFQASYDDLPTFQFFVIAIAIVGGYLVLSLPFSIVAIVRPHAVGPR LLLIILDAVALTLNTAAGAAAAAIVYLAHNGNSNTNWLAICQQYGDFCQKVSGAVVASFI TVVIFVFLIVLSAFALRRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL
BNC471045-100 1x 100 µL

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-500 1x 500 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
BNC740034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-100 1x 100 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details