Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_798217 (POPTRDRAFT_798217)

This Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_798217 (POPTRDRAFT_798217) spans the amino acid sequence from region 1-199.

Product Specifications

Product Name Alternative

CASP-like protein POPTRDRAFT_798217

UniProt

B9GIE4

Expression Region

1-199

Origin

Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALQSEEKLEVGYSSLQPKTRKWVLLMLRVLAFFATAAATVVMGLNKETKTLVVATVGST PIKASLTAKFQHTPAFVFFVIANGLASIHNLVMIMGDLFGQKLDYKGLRLAMIAILDIMT VALVSGGVSAAAFMAELGKNGNSHARWNKICDKFETFCDHGGGALIASFAGLILMLIISV MSIIKLLIKPKPDSTIVVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF594 conjugate, 0.1mg/mL
BNC940164-500 1x 500 µL

CD28 (204.12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-100 1x 100 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-100 1x 100 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF405S conjugate, 0.1mg/mL
BNC040176-500 1x 500 µL

CD5 (Cris-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (OV-TL12/30), CF488A conjugate, 0.1mg/mL
BNC880683-500 1x 500 µL

Cytokeratin 7 (OV-TL12/30), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details