Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YIR017W-A (YIR017W-A)
This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YIR017W-A (YIR017W-A) spans the amino acid sequence from region 1-199.
Product Specifications
Product Name Alternative
Putative uncharacterized protein YIR017W-A
UniProt
Q03885
Expression Region
1-199
Origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFRLLMSFNNFKDLISLMSLSFAFQNSFSLFNCSIRSRSLLICVFKFCSLFMFSKFFCFL RMRNRCDASVFFLLRSCLILSSSLEVLTGASSSFTTTAVVAATFPFLGSRSFLNCETSWP LFIMLMSSSALPLLTSSNDSKREPSSESLDIRFCRCSERLFTFIPFLLAMSMFVDFFSHP CFALILTNKTICLRNYHWL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402853-500 1x 500 µL
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880227-100 1x 100 µL
Milk Fat Globulin (MFG-06), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details