Recombinant Neisseria meningitidis serogroup C / serotype 2a Glycerol-3-phosphate acyltransferase (plsY)
This Recombinant Neisseria meningitidis serogroup C / serotype 2a Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-200.
Product Specifications
Product Name Alternative
Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati
UniProt
A1KTU8
Expression Region
1-200
Origin
Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / FAM18)
Field of Research
Pharmacology & Drug Discovery
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFNIPAVAVSYLIGSLSFAVIVSKYYGMDDPRTYGSGNPGATNVLRSGKKKAAVLTLLGD AAKGLVAVLLARVLQEPLGLSDSAIAAVALAALVGHMWPVFFGFKGGKGVATALGVLLAL SPATALVCALIWLVMAFGFKVSSLAALTATIAAPLAALFFMPHLSWIWATLLIALLVLFR HKSNISNLLKGKEGKIGEKR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740158-500 1x 500 µL
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details