Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Claudin-11 (CLDN11)

This Recombinant Pongo abelii Claudin-11 (CLDN11) spans the amino acid sequence from region 1-200.

Product Specifications

Product Name Alternative

Claudin-11

UniProt

Q5REK8

Expression Region

1-200

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT GLYHCKPLVDILPCRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLL ILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGE NRFYYTAGSSSPTHAKSAHV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFBR3 siRNA (Human)
orb1863436-01 15 nmol

TGFBR3 siRNA (Human)

Sign In for Pricing
View Details
TGFBR3 siRNA (Human)
orb1863436-02 30 nmol

TGFBR3 siRNA (Human)

Sign In for Pricing
View Details
Rabbit Monoclonal SUMO2/3 Antibody (6R8G7)
NBP3-16540-100ul 100 µL

Rabbit Monoclonal SUMO2/3 Antibody (6R8G7)

Sign In for Pricing
View Details
L-2,3-Diaminopropionic acid hydrochloride
GM2424-5ml 5 mL

L-2,3-Diaminopropionic acid hydrochloride

Sign In for Pricing
View Details
Anti-CD47 Antibody (CC-90002)
F1224-5 5 mg

Anti-CD47 Antibody (CC-90002)

Sign In for Pricing
View Details
1,4,7,10-Tetrakis (aminocarbonylmethyl) -1,4,7,10-tetraazacyclotridecane
sc-297960 250 mg

1,4,7,10-Tetrakis (aminocarbonylmethyl) -1,4,7,10-tetraazacyclotridecane

Sign In for Pricing
View Details