Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 3 (qoxC)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 3 (qoxC) spans the amino acid sequence from region 1-201.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 3, EC= 1.10.3.-, Quinol oxidase polypeptide III

UniProt

Q2FI19

Expression Region

1-201

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHDTNTIDSRTHEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYAGKMTTELFEL PLVLIMTFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASE GVNPTIGSYWSSFFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHF LDVVWVFIFTAVYMIGMVYSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Chk1 (S317) Recombinant Rabbit Monoclonal Antibody [PSH03-84]
HA722050 100 µL

Phospho-Chk1 (S317) Recombinant Rabbit Monoclonal Antibody [PSH03-84]

Sign In for Pricing
View Details
Tissue Total RNA, Prostate
CR563013 5 µg

Tissue Total RNA, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS707388 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
BFAR Human Gene Knockout Kit (CRISPR)
KN400078 1 Kit

BFAR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF640R conjugate, 0.1mg/mL
BNC402474-100 1x 100 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LOC102723360 activation kit by CRISPRa
GA119529 1 Kit

Human LOC102723360 activation kit by CRISPRa

Sign In for Pricing
View Details