Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 3 (qoxC)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 3 (qoxC) spans the amino acid sequence from region 1-201.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 3, EC= 1.10.3.-, Quinol oxidase polypeptide III

UniProt

Q7A6A0

Expression Region

1-201

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHDTNTIDSRTHEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYAGKMTTELFEL PLVLIMTFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASE GVNPTIGSYWSSFFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHF LDVVWVFIFTAVYMIGMVYSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATR Rabbit Polyclonal Antibody
TA373854 100 µL

ATR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Dnm1 activation kit by CRISPRa
GA201105 1 Kit

Mouse Dnm1 activation kit by CRISPRa

Sign In for Pricing
View Details
RuFluor™ succinimidyl ester
1520-AAT 1 mg

RuFluor™ succinimidyl ester

Sign In for Pricing
View Details
DCDC5 (NM_020869) Human Over-expression Lysate
LY434455 100 µg

DCDC5 (NM_020869) Human Over-expression Lysate

Sign In for Pricing
View Details
1-(3-Chloropropoxy)-4-fluorobenzene
TRC-C367680-5G 5 g

1-(3-Chloropropoxy)-4-fluorobenzene

Sign In for Pricing
View Details
IER3IP1 Human Gene Knockout Kit (CRISPR)
KN403042 1 Kit

IER3IP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details