Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 3 (qoxC)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 3 (qoxC) spans the amino acid sequence from region 1-201.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 3, EC= 1.10.3.-, Quinol oxidase polypeptide III

UniProt

Q7A183

Expression Region

1-201

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHDTNTIDSRTHEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYAGKMTTELFEL PLVLIMTFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASE GVNPTIGSYWSSFFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHF LDVVWVFIFTAVYMIGMVYSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NINJ1/Ninjurin-1 Rabbit Polyclonal Antibody
HA500367 100 µL

NINJ1/Ninjurin-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ube2d2b Rabbit Polyclonal Antibody
TA363591 100 µL

Ube2d2b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF405S conjugate, 0.1mg/mL
BNC041557-100 1x 100 µL

CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human EFCAB9 activation kit by CRISPRa
GA117237 1 Kit

Human EFCAB9 activation kit by CRISPRa

Sign In for Pricing
View Details
SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone ID: OTI5G7]
CF808424 100 µg

SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone ID: OTI5G7]

Sign In for Pricing
View Details
Metribolone
TRC-M338820-50MG 50 mg

Metribolone

Sign In for Pricing
View Details