Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 3 (qoxC)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 3 (qoxC) spans the amino acid sequence from region 1-201.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 3, EC= 1.10.3.-, Quinol oxidase polypeptide III

UniProt

Q6GI25

Expression Region

1-201

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHDTNTIDSRTHEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYAGKMTTELFEL PLVLIMTFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASE GVNPTIGSYWSSFFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHF LDVVWVFIFTAVYMIGMVYSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP43 Antibody
KC-2227-01 50 μL

CEP43 Antibody

Sign In for Pricing
View Details
CEP43 Antibody
KC-2227-02 100 µL

CEP43 Antibody

Sign In for Pricing
View Details
CEP43 Antibody
KC-2227-03 1 mL

CEP43 Antibody

Sign In for Pricing
View Details
7-Bromo-5-(2-fluorophenyl)-1,3-dihydro-3-hydroxy-2H-1,4-benzodiazepin-2-one
TRC-B682270-5MG 5 mg

7-Bromo-5-(2-fluorophenyl)-1,3-dihydro-3-hydroxy-2H-1,4-benzodiazepin-2-one

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD161 Antibody[3.2.3]
E-AB-F1307M1-01 50 Tests

Elab Fluor® 700 Anti-Rat CD161 Antibody[3.2.3]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD161 Antibody[3.2.3]
E-AB-F1307M1-02 100 Tests

Elab Fluor® 700 Anti-Rat CD161 Antibody[3.2.3]

Sign In for Pricing
View Details