Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermosynechococcus vulcanus Cytochrome c oxidase subunit 3 (ctaE)

This Recombinant Thermosynechococcus vulcanus Cytochrome c oxidase subunit 3 (ctaE) spans the amino acid sequence from region 1-201.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome aa3 subunit 3, Cytochrome c oxidase polypeptide III, Oxidase aa (3) subunit 3

UniProt

P50677

Expression Region

1-201

Origin

Thermosynechococcus vulcanus (Synechococcus vulcanus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQGTVESQGTAIAVDHAHEHPDFRVLGLLVFLISESLMFGGLFAAYLLLRGMHEQWPPEG TEVELFVPTINTLILISSSFVIHYGDVAIKKDDVRGMRKWYWITAAMGAVFLGGQVYEYL TLGYGLRTNVFANCFYVMTGFHGLHVFIGILLILGVIWRSRRPGHYNAQKHTGVAMAEIY WHFVDVIWIILFTLLYILTRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-100 1x 100 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-500 1x 500 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (C-04), CF647 conjugate, 0.1mg/mL
BNC470041-100 1x 100 µL

Cytokeratin 18 (C-04), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF594 conjugate, 0.1mg/mL
BNC942074-500 1x 500 µL

Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details