Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable cytochrome c oxidase subunit 3 (ctaE)

This Recombinant Probable cytochrome c oxidase subunit 3 (ctaE) spans the amino acid sequence from region 1-202.

Product Specifications

Product Name Alternative

Probable cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome aa3 subunit 3, Cytochrome c oxidase polypeptide III

UniProt

O69582

Expression Region

1-202

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSTVGTLGTAITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTARAQAGGKWPP STELNLYQAVPVTLVLIASSFTCQMGVFSAERGDVFGLRRWYVITLLMGLFFVLGQGYEY YHLITHGTTIPSSAYGSVFYLATGFHGLHVTGGLIAFIFLLARTTMSKFTPAQATASIVV SYYWHFVDIVWIALFTVIYFIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MIF Protein
PKSH032727-01 20 µg

Recombinant Human MIF Protein

Sign In for Pricing
View Details
Recombinant Human MIF Protein
PKSH032727-02 100 µg

Recombinant Human MIF Protein

Sign In for Pricing
View Details
Neuronal membrane glycoprotein M6 a (GPM6A) (NM_201591) Human Recombinant Protein
TP305371M 100 µg

Neuronal membrane glycoprotein M6 a (GPM6A) (NM_201591) Human Recombinant Protein

Sign In for Pricing
View Details
Wdr72 Mouse Gene Knockout Kit (CRISPR)
KN519382 1 Kit

Wdr72 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,2,2-Trichloroethyl Chloroformate
TRC-T774340-1G 1 g

2,2,2-Trichloroethyl Chloroformate

Sign In for Pricing
View Details
SensiStain™ Anti-PD-1 Antibody
HY000211 0.1 mL

SensiStain™ Anti-PD-1 Antibody

Sign In for Pricing
View Details