Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. indica CASP-like protein OsI_03581 (OsI_03581)

This Recombinant Oryza sativa subsp. indica CASP-like protein OsI_03581 (OsI_03581) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

CASP-like protein OsI_03581

UniProt

B8A927

Expression Region

1-204

Origin

Oryza sativa subsp. indica (Rice)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSIGNGRNGSEVGIQIPAMGNKEVLERPAIPRWPRLGVVMVATRAVALVMAVLSMALMI SAKQRGSLKIFGIEIPLYANWSFSDSLEYLVGMSAVSAAYCLAQLLLTAHKAVKNAPVVQ SRNYAWLLFTGDQIFAYAMMSAGSAAAAVANLNRTGIRHTALPNFCKPLPRFCDLSAASI ACAFLSCIFLAASAVIDVIWLSNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-100 1x 100 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgM Immunoglobulin (Cocktail), CF405S conjugate, 0.1mg/mL
BNC040762-500 1x 500 µL

IgM Immunoglobulin (Cocktail), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serum Amyloid A (SAA/2868R), CF568 conjugate, 0.1mg/mL
BNC682868-100 1x 100 µL

Serum Amyloid A (SAA/2868R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details