Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis lyrata subsp. lyrata Casparian strip membrane protein ARALYDRAFT_478496 (ARALYDRAFT_478496)

This Recombinant Arabidopsis lyrata subsp. lyrata Casparian strip membrane protein ARALYDRAFT_478496 (ARALYDRAFT_478496) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

Casparian strip membrane protein ARALYDRAFT_478496

UniProt

D7LAP2

Expression Region

1-204

Origin

Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNESTTIDVPAESSSAMKGKAPLIGVARDHTTSGSGGYNRGLSIFDFLLRLAAIVAALA AAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTILRPL ATAPRLLLLVLDTAVLALNTAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQKSSGAV VSAFISVVFFTILVVISGVALKRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
BNC680009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-500 1x 500 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-100 1x 100 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details