Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis subsp. spizizenii Quinol oxidase subunit 3 (qoxC)

This Recombinant Bacillus subtilis subsp. spizizenii Quinol oxidase subunit 3 (qoxC) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

Quinol oxidase subunit 3, EC= 1.10.3.-, Oxidase aa (3) -600 subunit 3, Quinol oxidase aa3-600, subunit qoxC, Quinol oxidase polypeptide III

UniProt

E0TW65

Expression Region

1-204

Origin

Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHAEHGNSNAPMEYQSETGRLNILGFWIFLGAEIVLFSTLFATFFVLQNRTAGGVLPDE LFEVNLVMIMTFLLLISSFTCGIAVHEMRRGSLKGVVIWTIITLLLGAGFVGCEINEFVH YVHEGASLGTSAFWSGFFVLLGTHGTHVTIGIFWIIGILIQLKKRGLTPQTSSKIFISSL YWHFLDVVWIFIFTGVYLMGLGGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-100 1x 100 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL
BNC741037-100 1x 100 µL

CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-100 1x 100 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details