Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aquifex aeolicus Uncharacterized protein aq_577 (aq_577)

This Recombinant Aquifex aeolicus Uncharacterized protein aq_577 (aq_577) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

Uncharacterized protein aq_577

UniProt

O66845

Expression Region

1-204

Origin

Aquifex aeolicus (strain VF5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVEVLRSSTFLLLRNWEFTLAWIVFFTIPLVITPLPYVGFLAFFFILLFFNSTTQYFVKV LSKNEKSLEIKEIFKIKKPVFSFSLGESVYLFFTALLYYLFTKFYAVLFFWWWFYKPFLE KELYYARTFEDGFKALLILLLRPNWKYIKLGLRWSFIGLVLLTIAVLLVLSIAGVLLASF VVLLLSVVLAHFTAETILRIKTLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC anti-human CD183 (CXCR3)
E16FHF183-025 25 Tests

FITC anti-human CD183 (CXCR3)

Sign In for Pricing
View Details
SIRT1 (NM_012238) Human Tagged Lenti ORF Clone
RC218134L1 10 µg

SIRT1 (NM_012238) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TMOD4 Antibody
CSB-PA609953ESR2HU-01 50 μL

TMOD4 Antibody

Sign In for Pricing
View Details
TMOD4 Antibody
CSB-PA609953ESR2HU-02 100 µL

TMOD4 Antibody

Sign In for Pricing
View Details
Rat IL-33 (Interleukin-33) ELISA Kit
ER1903 96 Tests

Rat IL-33 (Interleukin-33) ELISA Kit

Sign In for Pricing
View Details
CUL9 Protein Lysate (Mouse) with C-HA Tag
17142034 100 µg

CUL9 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details