Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Tetraspanin-13 (Tspan13)

This Recombinant Rat Tetraspanin-13 (Tspan13) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

Tetraspanin-13, Tspan-13, Transmembrane 4 superfamily member 13

UniProt

Q5FVL6

Expression Region

1-204

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVCGGFSCSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIA LVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNREQQGQLLEVGWNNTASARN DIQRNLNCCGFRNYNPNDTCPASCAKSNQKCSSCAPIIGEYAGEVLRFVGGIGLFFSFTE ILGVWLTYRYRNQKDPRANPSAFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
BNC051429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
BNC470204-100 1x 100 µL

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-100 1x 100 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL
BNC140146-500 1x 500 µL

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-100 1x 100 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details