Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

Q7V5Y3

Expression Region

1-204

Origin

Prochlorococcus marinus (strain MIT 9313)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNSLFGNLLSLVMGYLLGSLPSGYLAAHWLAGIDLREKGSGSTGATNVLRQVGKGPALA VFLIDVGKGTTAVLVARALELDDGWQVAAGLAALAGHIWPVWLGWKGGKAVATGLGMLLG ISWPVGLACFGIFLTVLSFSRIVSLSSIIAALSLPLLMILRFQGNSPPAYLAVAFAAMAM VVWRHRSNLQRLLAGTEPRLGQSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Helicobacter pylori Monoclonal Antibody (Clone: HP/1335)
36-3785-100 100 µg

Anti-Helicobacter pylori Monoclonal Antibody (Clone: HP/1335)

Sign In for Pricing
View Details
M40 acetate (143896-17-7 free base)
MBS5765505 Inquire

M40 acetate (143896-17-7 free base)

Sign In for Pricing
View Details
EphB4 Receptor Tyrosine Kinase (Biotin)
MBS6258393-01 0.1 mL

EphB4 Receptor Tyrosine Kinase (Biotin)

Sign In for Pricing
View Details
EphB4 Receptor Tyrosine Kinase (Biotin)
MBS6258393-02 5x 0.1 mL

EphB4 Receptor Tyrosine Kinase (Biotin)

Sign In for Pricing
View Details
RNU6-15 AAV Vector (Human) (CMV)
40435101 1 µg

RNU6-15 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
PCMP-E92 Antibody
orb793947 2 mg

PCMP-E92 Antibody

Sign In for Pricing
View Details