Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus 11 Replication protein E1 (E1), partial

Product Specifications

Product Name Alternative

ATP-dependent helicase E1

Abbreviation

Recombinant Human papillomavirus 11 E1 protein, partial

Gene Name

E1

UniProt

P04014

Expression Region

452-602aa

Organism

Human papillomavirus 11

Target Sequence

IEFIPFLSKLKLWLHGTPKKNCIAIVGPPDTGKSCFCMSLIKFLGGTVISYVNSCSHFWLQPLTDAKVALLDDATQPCWTYMDTYMRNLLDGNPMSIDRKHRALTLIKCPPLLVTSNIDISKEEKYKYLHSRVTTFTFPNPFPFDRNGNAV

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

ATP-dependent DNA helicase required for initiation of viral DNA replication. It forms a complex with the viral E2 protein. The E1-E2 complex binds to the replication origin which contains binding sites for both proteins. During the initial step, a dimer of E1 interacts with a dimer of protein E2 leading to a complex that binds the viral origin of replication with high specificity. Then, a second dimer of E1 displaces the E2 dimer in an ATP-dependent manner to form the E1 tetramer. Following this, two E1 monomers are added to each half of the site, which results in the formation of two E1 trimers on the viral ori. Subsequently, two hexamers will be created. The double hexamer acts as a bi-directional helicase machinery and unwinds the viral DNA and then recruits the host DNA polymerase to start replication.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.1 kDa

References & Citations

"Proteins of the PIAS family enhance the sumoylation of the papillomavirus E1 protein." Rosas-Acosta G., Langereis M.A., Deyrieux A., Wilson V.G. Virology 331:190-203 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Prdm4 (NM_001302886) AAV Particle
MR231162A1V 250 µL

Mouse Prdm4 (NM_001302886) AAV Particle

Sign In for Pricing
View Details
RIPPLY2 CRISPR Knock Out 293T Cell Line (Human)
39615141 1x 10^6 Cells / 1.0 mL

RIPPLY2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Porcine GALR1 ELISA Kit
EPG0084 96 Tests

Porcine GALR1 ELISA Kit

Sign In for Pricing
View Details
Anti-LCN12 Antibody
CTA4477-01 30 µL

Anti-LCN12 Antibody

Sign In for Pricing
View Details
Anti-LCN12 Antibody
CTA4477-02 50 μL

Anti-LCN12 Antibody

Sign In for Pricing
View Details
Anti-LCN12 Antibody
CTA4477-03 100 µL

Anti-LCN12 Antibody

Sign In for Pricing
View Details