Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-13 (Tspan13)

This Recombinant Mouse Tetraspanin-13 (Tspan13) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

Tetraspanin-13, Tspan-13, Transmembrane 4 superfamily member 13

UniProt

Q9D8C2

Expression Region

1-204

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVCGGFSCSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIA LVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNREQQGQLLEVGWNNTASARN DIQRNLNCCGFRSYNPNDTCPASCAKSTQKCSSCAPIIGEYAGEVLRFVGGIGLFFSFTE ILGVWLTYRYRNQKDPRANPSAFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BHLHE40, N-Strep II, C-His Tag
HA210574-01 20 µg

Human BHLHE40, N-Strep II, C-His Tag

Sign In for Pricing
View Details
Human BHLHE40, N-Strep II, C-His Tag
HA210574-02 50 µg

Human BHLHE40, N-Strep II, C-His Tag

Sign In for Pricing
View Details
Human BHLHE40, N-Strep II, C-His Tag
HA210574-03 100 µg

Human BHLHE40, N-Strep II, C-His Tag

Sign In for Pricing
View Details
TRIB3 (N-term) Rabbit Polyclonal Antibody
AP15157PU-N 400 µL

TRIB3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RNF17 Polyclonal Antibody
E-AB-90684-01 60 µL

RNF17 Polyclonal Antibody

Sign In for Pricing
View Details
RNF17 Polyclonal Antibody
E-AB-90684-02 120 µL

RNF17 Polyclonal Antibody

Sign In for Pricing
View Details