Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-13 (Tspan13)

This Recombinant Mouse Tetraspanin-13 (Tspan13) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

Tetraspanin-13, Tspan-13, Transmembrane 4 superfamily member 13

UniProt

Q9D8C2

Expression Region

1-204

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVCGGFSCSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIA LVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNREQQGQLLEVGWNNTASARN DIQRNLNCCGFRSYNPNDTCPASCAKSTQKCSSCAPIIGEYAGEVLRFVGGIGLFFSFTE ILGVWLTYRYRNQKDPRANPSAFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEAB (CLP1) Rabbit Monoclonal Antibody
TA424319 100 µL

HEAB (CLP1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CibenzolineSuccinate
TRC-C535725-5MG 5 mg

CibenzolineSuccinate

Sign In for Pricing
View Details
Crybb3 Mouse Gene Knockout Kit (CRISPR)
KN503866 1 Kit

Crybb3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human FBN1 (Fibrillin 1) CLIA Kit
E-CL-H1335-01 24 Tests

Human FBN1 (Fibrillin 1) CLIA Kit

Sign In for Pricing
View Details
Human FBN1 (Fibrillin 1) CLIA Kit
E-CL-H1335-02 48 Tests

Human FBN1 (Fibrillin 1) CLIA Kit

Sign In for Pricing
View Details
Human FBN1 (Fibrillin 1) CLIA Kit
E-CL-H1335-03 96 Tests

Human FBN1 (Fibrillin 1) CLIA Kit

Sign In for Pricing
View Details