Recombinant Corynebacterium glutamicum Cytochrome c oxidase subunit 3 (ctaE)
This Recombinant Corynebacterium glutamicum Cytochrome c oxidase subunit 3 (ctaE) spans the amino acid sequence from region 1-205.
Product Specifications
Product Name Alternative
Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome aa3 subunit 3, Cytochrome c oxidase polypeptide III
UniProt
Q9AEL8
Expression Region
1-205
Origin
Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTSAVGNTGMAAPQRVAALNRPNMVSVGTIVFLSQELMFFAGLFAMYFVSRANGLANGSW GEQTDHLNVPYALLITVILVSSSVTCQFGVFAAERGDVYGLRKWFLVTIILGSIFVIGQG YEYITLVGHGLTIQSSVYGSAFFITTGFHALHVIAGVMAFVVVLMRIHKSKFTPAQATAA MVVSYYWHFVDVVWIGLFITIYFIQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400994-500 1x 500 µL
TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400050-500 1x 500 µL
IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880460-500 1x 500 µL
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details