Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction epsilon-1 protein (Gje1)

This Recombinant Mouse Gap junction epsilon-1 protein (Gje1) spans the amino acid sequence from region 1-205.

Product Specifications

Product Name Alternative

Gap junction epsilon-1 protein, Connexin-23, Cx23

UniProt

Q9CX92

Expression Region

1-205

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLNYIKNFYEGCVKPPTVIGQFHTLFFGSVRMFFLGVLGFAVYGNEALHFSCDPDKREI NLFCYNQFRPITPQVFWALQLVIVLLPGAIFHLYAACKSINQDCILQKPVYTVIYVLSVL LRISLEVFAFWLQIHLFGFQVKPIYLCDTESLGKKPNILKCMVPEHFEKTIFLIAMYTFT VITMVLCVAEVFEIIFRRSCFLFKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1E2 Rabbit Polyclonal Antibody
TA369651 100 µL

ATP6V1E2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS509644 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
ORC1 (7F6/1), 0.2mg/mL
BNUB3067-500 1x 500 µL

ORC1 (7F6/1), 0.2mg/mL

Sign In for Pricing
View Details
Human THUMPD2 activation kit by CRISPRa
GA112966 1 Kit

Human THUMPD2 activation kit by CRISPRa

Sign In for Pricing
View Details
Fluorescein-12-dUTP, lyophilized powder
#40063 1x 25 nmol

Fluorescein-12-dUTP, lyophilized powder

Sign In for Pricing
View Details
Mouse Hmgb3 activation kit by CRISPRa
GA201918 1 Kit

Mouse Hmgb3 activation kit by CRISPRa

Sign In for Pricing
View Details