Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction epsilon-1 protein (Gje1)

This Recombinant Mouse Gap junction epsilon-1 protein (Gje1) spans the amino acid sequence from region 1-205.

Product Specifications

Product Name Alternative

Gap junction epsilon-1 protein, Connexin-23, Cx23

UniProt

Q9CX92

Expression Region

1-205

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLNYIKNFYEGCVKPPTVIGQFHTLFFGSVRMFFLGVLGFAVYGNEALHFSCDPDKREI NLFCYNQFRPITPQVFWALQLVIVLLPGAIFHLYAACKSINQDCILQKPVYTVIYVLSVL LRISLEVFAFWLQIHLFGFQVKPIYLCDTESLGKKPNILKCMVPEHFEKTIFLIAMYTFT VITMVLCVAEVFEIIFRRSCFLFKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Twinkle (TWNK) (NM_001163812) Human Over-expression Lysate
LC431501 20 µg

Twinkle (TWNK) (NM_001163812) Human Over-expression Lysate

Sign In for Pricing
View Details
DGAT1 (NM_012079) Human Over-expression Lysate
LY402142 100 µg

DGAT1 (NM_012079) Human Over-expression Lysate

Sign In for Pricing
View Details
NLRP8 Human Gene Knockout Kit (CRISPR)
KN418775 1 Kit

NLRP8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CARD11 Human Gene Knockout Kit (CRISPR)
KN222740BN 1 Kit

CARD11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TentaGel® R HMPA
R28015.5G 5 g

TentaGel® R HMPA

Sign In for Pricing
View Details
INS Polyclonal Antibody
E-AB-67409-01 60 µL

INS Polyclonal Antibody

Sign In for Pricing
View Details