Recombinant Human herpesvirus 6B G-protein coupled receptor (U12)
This Recombinant Human herpesvirus 6B G-protein coupled receptor (U12) spans the amino acid sequence from region 1-205.
Product Specifications
Product Name Alternative
G-protein coupled receptor
UniProt
Q9QJ51
Expression Region
1-205
Origin
Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDTVIELSKLLHDEEFKDNASCTSTPTLKTARIIESAVTGITLTASVPMIIIVITTMILY HRVAKHNATSFYVITLFASDFVLMWCVFFMTVNREQLFSFNRFFCQLVYFIYHAVCSYSI SMLAIIATIRYKTLHRRKQTESKTYSTGRNIGILLLASSMCAIPTALFVQINGAKKTTGK CVVYLSSPKAYELFLAVKIVFSFIW
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680745-500 1x 500 µL
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942616-100 1x 100 µL
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details