Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Threonine efflux protein (rhtC)

This Recombinant Threonine efflux protein (rhtC) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Threonine efflux protein

UniProt

Q8Z3B3

Expression Region

1-206

Origin

Salmonella typhi

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMLFFTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGVALLGL HLIIEKMAWLHTIIMVGGGLYLCWMGYQMLRGALKKQDAAASSPHIELAQSGRSFLKGLL TNLSNPKAIIYFGSVFSLFVGDNVGAAARWGIFALITLETLAWFTVVASLFALPKMRRGY QRLAKWIDGFAGALFAGFGIHLIISR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Ataxin 2 Antibody
MBS821264-01 0.03 mL

Anti-Ataxin 2 Antibody

Sign In for Pricing
View Details
Anti-Ataxin 2 Antibody
MBS821264-02 0.05 mL

Anti-Ataxin 2 Antibody

Sign In for Pricing
View Details
Anti-Ataxin 2 Antibody
MBS821264-03 0.1 mL

Anti-Ataxin 2 Antibody

Sign In for Pricing
View Details
Anti-Ataxin 2 Antibody
MBS821264-04 0.2 mL

Anti-Ataxin 2 Antibody

Sign In for Pricing
View Details
Anti-Ataxin 2 Antibody
MBS821264-05 5x 0.2 mL

Anti-Ataxin 2 Antibody

Sign In for Pricing
View Details
PKM Goat Polyclonal Antibody
TA396718S 25 µL

PKM Goat Polyclonal Antibody

Sign In for Pricing
View Details