Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Emopamil-binding protein-like (Ebpl)

This Recombinant Mouse Emopamil-binding protein-like (Ebpl) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Emopamil-binding protein-like, Emopamil-binding-related protein

UniProt

Q9D0P0

Expression Region

1-206

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEHWALGPEAGSSLLLCSALLAVGCALGLRLGRGRSAVERWVLAWLCYDSLVHFVLEGA FVYLSIVGNVADSQGLIASLWKEYGKADTRWLYSDPTVVSLEILTVVLDGLLALVLIYAI VKEKYYRHFVQIVLCVCELYGCWMTFFPEWLVGSPSLNTSSWLYLWVYLVFFNGLWVLIP GLLLWQSWVELKKRDSQEANLAKKHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF154 Antibody (N-term)
orb32044-01 50 µL

ZNF154 Antibody (N-term)

Sign In for Pricing
View Details
ZNF154 Antibody (N-term)
orb32044-02 100 µL

ZNF154 Antibody (N-term)

Sign In for Pricing
View Details
Ankyrin 1, Erythrocytic, Variant 2.1, Human (ANK1, ANK, SPH1, SPH2) discontinued
A2295-19B 50 µg

Ankyrin 1, Erythrocytic, Variant 2.1, Human (ANK1, ANK, SPH1, SPH2) discontinued

Sign In for Pricing
View Details
Beef Extract Paste For Bacteriology
35800500 500 mg

Beef Extract Paste For Bacteriology

Sign In for Pricing
View Details
Mouse Ndufa2 Pre-designed siRNA Set B
SI109177B 1 Each

Mouse Ndufa2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
JUN peptide
orb217498-01 1 mg

JUN peptide

Sign In for Pricing
View Details