Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Emopamil-binding protein-like (Ebpl)

This Recombinant Mouse Emopamil-binding protein-like (Ebpl) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Emopamil-binding protein-like, Emopamil-binding-related protein

UniProt

Q9D0P0

Expression Region

1-206

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEHWALGPEAGSSLLLCSALLAVGCALGLRLGRGRSAVERWVLAWLCYDSLVHFVLEGA FVYLSIVGNVADSQGLIASLWKEYGKADTRWLYSDPTVVSLEILTVVLDGLLALVLIYAI VKEKYYRHFVQIVLCVCELYGCWMTFFPEWLVGSPSLNTSSWLYLWVYLVFFNGLWVLIP GLLLWQSWVELKKRDSQEANLAKKHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JWH-073 (Indole-d5) 3-Hydroxybutyl
452936 1 mg

JWH-073 (Indole-d5) 3-Hydroxybutyl

Sign In for Pricing
View Details
C1QT6 rabbit pAb
MBS8600690-01 0.1 mL

C1QT6 rabbit pAb

Sign In for Pricing
View Details
C1QT6 rabbit pAb
MBS8600690-02 0.1 mL (AF405L)

C1QT6 rabbit pAb

Sign In for Pricing
View Details
C1QT6 rabbit pAb
MBS8600690-03 0.1 mL (AF405S)

C1QT6 rabbit pAb

Sign In for Pricing
View Details
C1QT6 rabbit pAb
MBS8600690-04 0.1 mL (AF610)

C1QT6 rabbit pAb

Sign In for Pricing
View Details
C1QT6 rabbit pAb
MBS8600690-05 0.1 mL (AF635)

C1QT6 rabbit pAb

Sign In for Pricing
View Details